PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G1517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 566aa    MW: 61590.5 Da    PI: 4.6766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G1517genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
      Gh_A06G1517 40 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding53.94.2e-1793136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
      Gh_A06G1517  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0373587IPR017930Myb domain
SMARTSM007172.4E-153989IPR001005SANT/Myb domain
SuperFamilySSF466892.62E-3039134IPR009057Homeodomain-like
PfamPF002492.4E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-244194IPR009057Homeodomain-like
CDDcd001676.62E-124287No hitNo description
PROSITE profilePS5129426.87288142IPR017930Myb domain
SMARTSM007172.3E-1792140IPR001005SANT/Myb domain
PfamPF002494.5E-1693136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2695141IPR009057Homeodomain-like
CDDcd001671.15E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MSHTKNERED GILSKDQTES SLIDDGNCGG GTGGGVVLKK GPWTSAEDAI LIDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVCLQALQD SHGTSAVNGG DKGPHDILQN  180
NSYEIPDVIF DSLKTSQNVL PYVPELPDIS TSSMLMKGLG SQYCSFMPPT IHRQKRLREA  240
TAFFPGYTGA VKNECPLFEQ FQDDISDKAA QSFGLSFPIE PDPATKNSLQ FGVFPGSHNL  300
SNGNFSASEP PLEAVKLELP SLQYPETELG NWGTFSCPPP LLESVDAFIQ SPPPTSIAES  360
DSLSPHNSGL LDALLHEAKT LSSAKNHASE KSSNSATPGD VAESSTFNIC ETEWENCGEP  420
LSPMGHSATS LLSECISASG STLDEQPPAE TFTVCSNSIL DCFSESQVKS EPADHVFTPE  480
IQNEAPIRLD SCHPDTLLAS NWLEQDSGYD KDQTIMTDSI AAHLGDDLST EYKNMAAGTS  540
ISSQAWGLGS CAWNNMPAVC QMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32381415107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591461e-56AJ459146.1 Gossypium hirsutum partial myb118 gene, clone pGhMYB118.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451648.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012451647.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012451646.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0D2VD820.0A0A0D2VD82_G
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-141myb domain protein 33